SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006728938.1.47382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006728938.1.47382
Domain Number 1 Region: 37-155
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-38
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 143-269
Classification Level Classification E-value
Superfamily FKBP-like 6.48e-37
Family FKBP immunophilin/proline isomerase 0.00034
Further Details:      
 
Domain Number 3 Region: 261-372
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-36
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 4 Region: 378-453
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000034
Family Calbindin D9K 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006728938.1.47382
Sequence length 464
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 [Leptonychotes weddellii]; AA=GCF_000349705.1; RF=representative genome; TAX=9713; STAX=9713; NAME=Leptonychotes weddellii; AL=Scaffold; RT=Major
Sequence
MAFRARGWRSPPPPPLLLLLLWVTGQAAPVAGLGLDTELQIERRFVPDECPRTVRSGDFV
RYHYVGTFSDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPKLAY
GSEGVSGVIPPDSVLHFDVLLMDIWNSEDQVQVHTYFTPPSCPRTIQVSDFVRYHYNGTF
LDGTLFDSSYSRNRTFDTYIGQGYVIAGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGEC
WLLPSNSVLHFDVLLMDIWNSEDQVQVHTYFTPPSCPRTIQVSDFVRYHYNGTFLDGTLF
DSRWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVVIPPHLGYGEAGVDGEVPGSAV
LVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKG
KLAPGFDAEVIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences XP_006728938.1.47382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]