SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006760154.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006760154.1.95426
Domain Number 1 Region: 29-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-92
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-33
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2177-2295
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-32
Family Pleckstrin-homology domain (PH domain) 0.0000202
Further Details:      
 
Domain Number 4 Region: 1642-1795
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 604-743
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 6 Region: 1534-1688
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-27
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 1853-2007
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1013-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-27
Family Spectrin repeat 0.00000364
Further Details:      
 
Domain Number 9 Region: 817-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 10 Region: 1231-1377
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-25
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 11 Region: 427-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 531-638
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-19
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 13 Region: 747-851
Classification Level Classification E-value
Superfamily Spectrin repeat 4.64e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 14 Region: 1984-2072
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000353
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1389-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000589
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006760154.1.95426
Sequence length 2332
Comment PREDICTED: spectrin beta chain, erythrocytic [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MTSATEFENVANQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARKSCRITDLYKDLRDGQMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVVPEGPEGRETRSAKDA
LLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAF
DVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRIGKVIDHAI
ETEKMIEKYSGLASDLLTWIEQTITILNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQE
KGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQE
KLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERV
RALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLASRRQRLETTLALQKLFQDML
HSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAINTATLQFTEGK
GYQPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQ
IYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQIFQEAEGMVARKQFGHPQIEARI
KEVSAQWAQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLTGEDVGQDEGAT
RALGKKHKDFLEELEESRAVMEHLERQAQSFPQEFRDSPDVTNRLQALRDLYQQVVAQAD
LRRQKLQEALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVVQHRFDILDQEMK
TLMTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSDRREAVGSALRVHN
YCVDCEETSKWILDKTKVVESTKDLGRDLTGVIAIQRKLSGLERDVAAIQTRVGALERES
RWLMESHPELKEDIGRRQAYVEELWQGLQQALQGQEASLGEASQLQAFLQELDDFQGWLS
MAQKAVASEDTPESLPEAEQLLQQHAAIKDEIDGHQDSYEHVKASGEKVLRGQTDPEYLL
LGQRLEGLGTGWDALRRMWESRGHFLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLETPD
SLEAAEAGIRKFEDFLVSMENNQDKVLSPVDSGNKLVAEGNLYADKIKEKVQSIEDRHRK
NNEKAQEASVLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAF
MAELASHEGWLESIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQATTKEKAQQLSAA
RSSDLRSKTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGEL
FAQMPSLDEEEGGADMSIEKRFLDLLEPLGKRKKQLESSRAKLQISRDLEDETLWVEERL
PLAQSSDYGINLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEEAEIDCGDIEER
LGHLQSSWDTLREAAAGRLRRLRDASEAQQYYLDAGEAEAWISEQELYVISDETPKDEEG
AIVMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLAAGHPEGEQIIRLQGQVDKQYAGLKDM
AEERKRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFARE
TGAIGQERVDNVNAIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYD
LHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDV
ATRLQMAYAGEKADAIQDKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSW
MESIIRQIETQERPRDVSSVELLMKYHQGIRAEIDTRSKNFNACLELGESLLQREHQASE
EIREKLQQVMSRRKEMNEKWEARWERLSMLLEVCQFSRDASVAEAWLIAQEPYLASRDFG
HTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIPETPVEETGPQEEEGET
AGEGPRGPHRAATERTSPGEEERQWPQDLQPPPPPGPQKEGQEEKSGGDERPATEPPKIL
DTPLSEGDEPITLPAQQDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNHLYCVLRNSELT
FYKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKVRLSNGSEWLFHGKDEEEM
LSWLQGVSTAINESQSIRVKAQSLPLPSITGPDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006760154.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]