SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006781118.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006781118.1.46954
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-54
Family YWTD domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 181-414
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-51
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 3 Region: 785-1046
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-40
Family YWTD domain 0.0000476
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-25
Family YWTD domain 0.0000558
Further Details:      
 
Domain Number 5 Region: 1175-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1096-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 740-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000436
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1137-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 438-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000351
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 135-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1054-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006781118.1.46954
Sequence length 1465
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like isoform X1 [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MYWTDWGEIPKIERAGMDGTNRSMIIDKEIYWPNGLTLDYSQQKLYWADAKHSFIHRSNL
DGSFREVVVKGELPHPFALTLFEDTLFWTDWTTHSIHSCRKQTGGGQRVVHSNIFSPMDI
HVFSTKRQHIAVNTPCSLNNGGCSHLCLLSPVRPFYRCACPTGVQLLEDGKTCRDGATEM
LLLARRTDLRRISLDMPDFTDIILQVDNIRHAIAIDYDPVEGYVYWTDDDVKAIRRSLLD
GSDPQFVVTSQVDHPDGIAVDWIARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRA
IVLDPVAGYMYWTDWGDVPKIERADLDGMERVVMVNTSLGWPNGLALDYEERKIYWGDAK
TDKIEVMNMDGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKRTAVREFIID
QLPDLMGLKATNVHEAFGTNPCADDNGGCSHLCLYKPQGVQCGCPIGLELIADMKTCIVP
EAFLLFSRHTDIRRISLETNSNNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSP
RALALDPAEGYMYWTEWGGKPKIDRAAMDGTGRITLVADVGRANGLTIDYAERRLYWTDL
DTTLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQ
GHLDYVMDILVFHSSRQGGWNACASTNGHCSHLCLAVPVSSFVCGCPAHFSLNYDNKTCS
APTSFLLFSQKTAINRMVIDEQQSPDIILPIHNLRNVRAIDYDPLDKQLYWIDSKQNVIR
RAQEDGNQSMTVVSGSLGGHSQGLQLYDLSIDIYSRFIYWTSEVTNVVNVTRIDGSRVGV
VLRGEHDKPRAIVVNPERGYMYFTNLMERSPKIERAALDGTEREVLFFSGLGKPVALAID
NEVGKLFWVDSDLRRIESSDLSGANRIVIADSNILQPVGLTVFGNHLYWIDKQQQMIERI
DKTTREGRTKIQARIAYLSDIHAVHELDMREYSKHPCTWENGGCSHICIVKGDGTTRCSC
PVHLVLLPDELSCGEPPTCSPEQFSCTSGEVDCIPQAWRCDGYAECDDGSDEEDCPVCSD
SEFQCDSRQCIELSLRCNGEINCQDKSDENKCEVRCPADQFTCFNGQCIGKHKKCDHNMD
CMDNSDETGCYPTEEPPPPPHNTIGSIVAVVMALFVVGAIYFVCQRVLCPQMKDDGETVT
NDFVVHGPSSVPLGYVPHPSSLSSSLPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASS
SSSSSTKGTYFPPILNPPPSPATVRSQYTVEFGYSSNSPSTHRSYSYRPYTYRHFAPPTT
PCSTDVCDSDYTPGRRAPLKSSAAAKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCP
PSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006781118.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]