SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006781119.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006781119.1.46954
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-54
Family YWTD domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 180-413
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-51
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 3 Region: 784-1045
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-40
Family YWTD domain 0.0000476
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-25
Family YWTD domain 0.0000558
Further Details:      
 
Domain Number 5 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1095-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000043
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1136-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000351
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 134-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1053-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006781119.1.46954
Sequence length 1464
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like isoform X2 [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MYWTDWGEIPKIERAGMDGTNRSMIIDKEIYWPNGLTLDYSQQKLYWADAKHSFIHRSNL
DGSFREVVVKGELPHPFALTLFEDTLFWTDWTTHSIHSCRKQTGGGQRVVHSNIFSPMDI
HVFSTKRQHIVNTPCSLNNGGCSHLCLLSPVRPFYRCACPTGVQLLEDGKTCRDGATEML
LLARRTDLRRISLDMPDFTDIILQVDNIRHAIAIDYDPVEGYVYWTDDDVKAIRRSLLDG
SDPQFVVTSQVDHPDGIAVDWIARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAI
VLDPVAGYMYWTDWGDVPKIERADLDGMERVVMVNTSLGWPNGLALDYEERKIYWGDAKT
DKIEVMNMDGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKRTAVREFIIDQ
LPDLMGLKATNVHEAFGTNPCADDNGGCSHLCLYKPQGVQCGCPIGLELIADMKTCIVPE
AFLLFSRHTDIRRISLETNSNNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPR
ALALDPAEGYMYWTEWGGKPKIDRAAMDGTGRITLVADVGRANGLTIDYAERRLYWTDLD
TTLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQG
HLDYVMDILVFHSSRQGGWNACASTNGHCSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSA
PTSFLLFSQKTAINRMVIDEQQSPDIILPIHNLRNVRAIDYDPLDKQLYWIDSKQNVIRR
AQEDGNQSMTVVSGSLGGHSQGLQLYDLSIDIYSRFIYWTSEVTNVVNVTRIDGSRVGVV
LRGEHDKPRAIVVNPERGYMYFTNLMERSPKIERAALDGTEREVLFFSGLGKPVALAIDN
EVGKLFWVDSDLRRIESSDLSGANRIVIADSNILQPVGLTVFGNHLYWIDKQQQMIERID
KTTREGRTKIQARIAYLSDIHAVHELDMREYSKHPCTWENGGCSHICIVKGDGTTRCSCP
VHLVLLPDELSCGEPPTCSPEQFSCTSGEVDCIPQAWRCDGYAECDDGSDEEDCPVCSDS
EFQCDSRQCIELSLRCNGEINCQDKSDENKCEVRCPADQFTCFNGQCIGKHKKCDHNMDC
MDNSDETGCYPTEEPPPPPHNTIGSIVAVVMALFVVGAIYFVCQRVLCPQMKDDGETVTN
DFVVHGPSSVPLGYVPHPSSLSSSLPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPILNPPPSPATVRSQYTVEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTP
CSTDVCDSDYTPGRRAPLKSSAAAKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPP
SPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006781119.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]