SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006798404.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006798404.1.46954
Domain Number 1 Region: 73-208
Classification Level Classification E-value
Superfamily FKBP-like 1.63e-40
Family FKBP immunophilin/proline isomerase 0.00024
Further Details:      
 
Domain Number 2 Region: 211-316
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-28
Family FKBP immunophilin/proline isomerase 0.0011
Further Details:      
 
Domain Number 3 Region: 331-395
Classification Level Classification E-value
Superfamily EF-hand 0.00000000284
Family Calbindin D9K 0.047
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily FKBP-like 0.00000157
Family FKBP immunophilin/proline isomerase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006798404.1.46954
Sequence length 409
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10-like [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MDLLACFQLLLLSHLLTVNCSPGPLLDVVVDRYDIPKVCPREVEIEDFVRYHFNGTFFED
GKKFDSRAECRTMIPPQATLVFEVLMVDVFNPKDDVIVEAKEVPKGCTRTTVTGDYIRYH
YNGTFQDGTLFDSSYQRNSTYNTYIGMGYVIQGMDKALQGLCIGEKRRVIIPPHLAYGEK
GVGDFIPGSAVLVFDIHVIDFHNPKDPVNIKVTHKPQECNMRSEADDLIQYRYNCSLMDG
TVLYTSDQFDSPSTTTLGANNVILGLEEGLRGMCVGERREVVIPPHFGHGENEAGGVPKS
AVLFFELELVELQKGVPEDYMFVWVGDGPDPLFPAMDLDGDKQVPLEEFSLFIRLQVQGG
KGRLRPGIDADSIIKDMFDNQDRNKDGKIVEDELTVTEDEVSKQARDEL
Download sequence
Identical sequences XP_006798404.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]