SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006822699.1.86028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006822699.1.86028
Domain Number 1 Region: 629-885
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-59
Family YWTD domain 0.00000347
Further Details:      
 
Domain Number 2 Region: 328-577
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000281
Further Details:      
 
Domain Number 3 Region: 18-277
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-53
Family YWTD domain 0.0000018
Further Details:      
 
Domain Number 4 Region: 938-1197
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-41
Family YWTD domain 0.0000345
Further Details:      
 
Domain Number 5 Region: 1246-1285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1286-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 585-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 280-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 1324-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 10 Region: 1203-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.022
Further Details:      
 
Domain Number 11 Region: 888-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006822699.1.86028
Sequence length 1609
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6-like [Saccoglossus kowalevskii]; AA=GCF_000003605.2; RF=representative genome; TAX=10224; STAX=10224; NAME=Saccoglossus kowalevskii; AL=Scaffold; RT=Major
Sequence
MVRVCIFGSILALIRGEPLLLYANRQDVRMVDTGTNPPNDTIIISGLEDAAALDFYHNEK
IVFWTDVSLEMIKRTFVNGSRIVENIITTGLVSPDGLACDWLGKKLYWTDSETNRIEVSN
LDGSSRKVLFWEDLDQPRAIALDPHRGWMYWTDWGETPKIERAGMDGIEREVIVQTDIYW
PNGLTIDYDAQRIYWADAKLNYIHHANFDGSDRSPVAEGSLPHPFALTLFTDTLFWTDWH
TRSIHSCHKNTGENRKVVHEDIFSPMDIHVYSAVRQPSGANPCGQNNGDCSHLCLMSPHP
PKYTCACPTGVRLLTNGRTCADGAEEILLLARRTDLRRISLDTPDYTDVVLQLEDIQHAI
AIDYDPVDGYIYWTDDEVRAIRRASMDGTGGEFIVTTEVEHPDGLAVDWVGRNLYWTDTG
NDRIEVARLNGTSRTILISEDLDEPRAIALDPADGYMYWTDWGSKPKIERAALDGTDRTV
LINSSLGWPNGIALDFIERKIYWGDAKTDKIEMANMDGTGRQVLVVDLPHIFGFSLLGDY
IYWTDWQRRSIERVNKHNGQDREVIIDQLPDLMGLKAVNVKKIEGTNVCAHDNGGCSHLC
LYRPIGVICACPIGLELLQDQKTCIVPEAFLLFSRRADIRRISLETNNNDVVIPLAGVKE
AAALDFDINDNRIYWSDIRRKAISRAFMNGSSLEHVIEFGLEYPEGMAVDWVAHNIYWAD
TGTNRIEVARLDGSARRVLLWQDLEEPRALALDPSEGFMYWTDWGGNPKIERANMDGSNR
KLIVTDVGRTNGLTIDYSDRRMYWTDLDMNQIESADLMGQHRRSVIGEKLPKPFGLTQYQ
DYIYWTDWATRSIERVNKTSGENRTRIQGQLDYVMDILVFHASRQSGSNQCALNNNGCEY
LCFADPPNLIGELQSHCACPTHYTLREDNKTCSPPESFLLYSQRNLISRMTVNLDDSPDI
VLPIHGLRIVKAIEYNYKTKQIYWVDGRTKTIKRSYDNGLEPETFLPNPGDEPKFHPHDL
ALDPYSGLIYWTCSQTNVINVTRLDMTEVGVVIRDDTEKPRAIVLDPERGYMYWTSVSQN
KPRIMRAAMDGADKTVIISSSLSEPEALAIDTESNKLFWSDVTLHRIESSDLNGGNRNVL
VDSQLSTPHALTIFGTHLYWIDKDSMLIERVDKINGDQREKILGRLTQLSDIHAVRNNYP
SADSHPCAINNGGCSHICFLVDGVKTCACPIDLVLSDSRTTCGEPPTCSPDHFTCKSGNI
ECIPQAWVCDTIPECADESDEQNCPTCSKLQFHCKSGQCIDKKLRCNGEPDCNDESDEKF
CQAPCWKDQFECSNGQCVDSELAECNDIIECDDGSDEVNCDHHSVVEPNTSPVRSAGSMH
SLIGAVVGFIFVIIVIGIAMWWWRRYKLQPDSMCDNQFVMLNNHQNNYTAMVGVGPQQTT
PPRSISGISKCHTKSINTCLSVSTVPAGSNVQHYDRSHVTGASSSGSSMGSHYPKETLNP
PPSPVTERSHYTAELYYPSHSPHASRSYRHYKSRNIPPPPTPCSTDVCEDSEPYSRPNKR
KYYSNPYPPPPTPQSVLSDNYESCPPSPSTERSFCNPYPPPPSPATDSP
Download sequence
Identical sequences XP_006822699.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]