SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006832211.1.41390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006832211.1.41390
Domain Number 1 Region: 153-265
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-37
Family FKBP immunophilin/proline isomerase 0.00032
Further Details:      
 
Domain Number 2 Region: 40-147
Classification Level Classification E-value
Superfamily FKBP-like 1.67e-33
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 3 Region: 260-365
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-33
Family FKBP immunophilin/proline isomerase 0.00039
Further Details:      
 
Domain Number 4 Region: 373-446
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000959
Family Calmodulin-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006832211.1.41390
Sequence length 457
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 isoform X4 [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence
MGFRARGWRPPLPPLLLLLLWVTGQAAPVAGLGLGPDTELQIERRFVPDECPRTVRSGDF
VRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIGLLGMCVGEKRIITIPPFLAYGEHG
DGKDIPGQASLVFDVALLDLHNPKDGISIENKIVPENCERRSQSGDFLRYHYNGTLLDGT
FFDSSYARNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSA
VLVFDIHVIDFHNPSDSISITSHYKPSDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLG
KTYNIVLGSGQVVLGMDMALREMCVGEKRTVVIPPHLGYGEAGVDGEVPGSAVLVFDIEL
LELVAGLPEGYMFIWNDEVSPNLFEEIDKDGNGEVFLEEFSEYIHAQVASGKGKLAPGFD
ADMIVKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL
Download sequence
Identical sequences XP_006832211.1.41390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]