SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006860895.1.41390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006860895.1.41390
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-55
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-39
Family YWTD domain 0.0000879
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-27
Family YWTD domain 0.0000799
Further Details:      
 
Domain Number 5 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 1133-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000233
Family EGF-type module 0.009
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000684
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000791
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006860895.1.41390
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGAKRKEILNALYSPMDI
QVLSQERQPHFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPVEGYVYWTDDEVRAIRRAYLDG
SGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGQERRVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCADGNGGCSHLCFFTPHATKCGCPMGLELLSDLKTCIVPE
AFLVFTSRAAIHRISLETTNNDVAIPLTGVKEASALDFDVSSNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLIWRDLDNPR
SLALDPTQGYIYWTEWSGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESANMLGQERVVITDDLPHPFGLTQYGEYIYWTDWNLHSIERADKISGQNRTLIQG
HLDFVMDILVFHSSRQDGFNDCMQSNGQCGQLCLAVPGGHRCGCASHYTLDPSSRNCSPP
TAFLLFSQKCAISRVIPDDPHSPDLILPLHGLRNVKAVDYDPLDKLMYWVDGRQNIKRAK
DDGTQPFLLTSPGQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEALGVVLRG
DRDKPRAIVVNSERGYLYFTNMQDHTAKIERAALDGTEREVLFTTGLIRPVALVVDNALG
KLFWVDADLKRLESCDLSGANRLTLEDANIVQPVGLAVLGRHLYWADRQQQMIERVDKSS
GEQRTRVQGRIAHLTSIHAVEEVSTEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPAAWRCDGFPECDDQSDEEGCPVCSAAQFP
CERGQCVDLSLRCDGEADCQDRSDEADCDAVCLPSQFRCASGQCVLIKQQCDSFPDCMDG
SDELLCEITKPPADDTPAHSSAIGPVIGIILSLFVMGGVYFVCQRIVCQRYAGASGPFPH
EYVSGTPHVPLNFIAPGGPQHGPFTGISCSKSMMSSMSLMGSRGGAPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNMDMFCSSNIPATARPYRPYIIRGMVPPTTPCS
TDVCDSDYSVSRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPITERGYFHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_006860895.1.41390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]