SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006887670.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006887670.1.29581
Domain Number 1 Region: 153-264
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-37
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 2 Region: 41-148
Classification Level Classification E-value
Superfamily FKBP-like 8.84e-34
Family FKBP immunophilin/proline isomerase 0.00027
Further Details:      
 
Domain Number 3 Region: 259-364
Classification Level Classification E-value
Superfamily FKBP-like 9.82e-34
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 4 Region: 372-445
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000444
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006887670.1.29581
Sequence length 456
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 isoform X2 [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MAFRVRGWQPPPLLLLLLWVTGQAAPVAGLGLGPNAELHIERRFVPDECPRTVHSGDFVR
YHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGLLGMCVGEKRIITIPPFLAYGENGD
GKDIPGQASLVFDVALLDLHNPKDGISIENKVVPADCERRSQSGDFLRYHYNGTLLDGTF
FDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAV
LVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGK
TYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELL
ELVAGLPEGYMFIWNDEVSPNLFEEIDKDGNGEVVLEEFSEYIHAQVASDKGKLAPGFDA
EMIVKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL
Download sequence
Identical sequences XP_006887670.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]