SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006891866.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006891866.1.29581
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-93
Family Calponin-homology domain, CH-domain 0.00000315
Further Details:      
 
Domain Number 2 Region: 2173-2293
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-30
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-28
Family Spectrin repeat 0.0000038
Further Details:      
 
Domain Number 7 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-28
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 6.96e-26
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 10 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-24
Family Spectrin repeat 0.00087
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-19
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000707
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006891866.1.29581
Sequence length 2330
Comment PREDICTED: spectrin beta chain, erythrocytic [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MTSATEFENEGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFEV
ADRQLGIIPLLDPEDVFTENPDEKSIITYVVSFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTIAVLNSRKFANSLAGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWTYLQELLRARRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTESQGY
RPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLKQVFQEAEDMVARKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAETFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALRELYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLSQMEIPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFKTMVSERREAVDSALRVHNYC
VDCEETSKWIMDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVGALERESQQ
LMESHSELKEDISQRQAYVEELWQGLQQALKGQEASLGEASQLQAFLQDLDDFQAWLSMA
QKAVASEDTPESLPEAEQLLQQHAAIKEEIDGHQESYQQVKVSGEKVIRGQTDPEYQLLG
QRLDGLDSGWDALCRMWESRSRSLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLMSMETNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHKKNE
EKAQEATVLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSFDESRNLHNKFLKHQAFVA
ELASHQGWLENIDAEGKALMEEKPHFAATVSQRLDALHQLWDELQAITKEKTRQLSAARS
SDLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELEELFA
QVPSMGEEVGDTDVSIERRFLDLLEPLGRRKKQLESSKAKLQISRDLEDETLWVEERLPL
AQSADYGINLQTVQLFMKKNQTLQNEIMGHTPRIESVLKRGHELVEAAEIDCQDIEERLG
HLQSSWDTLREAAAGRLQRLRDANEAQQYYLDAGEAEAWISEQELYVISDETPKDEEGAI
VMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLAAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERKRKLENMYHLFQLKREAEDLEQWISEKEQVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKEDAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFSACLELGESLLQRQHQASDEI
SEKLQQVVMRRKEMNEKWDARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPAEETGAQEEEGETAG
EAPRVPHPAATERTSPEEGETSWTQDLQPPPLPGQQERQEEKSLGDDGPATEPIFKVLDT
PLSEGDEPMTLPAQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFY
KDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLS
WLQGVSTAINESQSIRVKAQSLPLPSIAGTDVSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006891866.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]