SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006893302.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006893302.1.29581
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-55
Family YWTD domain 0.00000485
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-51
Family YWTD domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-39
Family YWTD domain 0.0000802
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-29
Family YWTD domain 0.0000845
Further Details:      
 
Domain Number 5 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 9 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.044
Further Details:      
 
Domain Number 10 Region: 134-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006893302.1.29581
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKTIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRSNL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEVLSALYSPMDI
QVLSPERQPHFHTQCEEDNGGCSHLCLLSPQEPFYTCACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRKISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVSTDINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVIDVDGTQRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLGDMKTCIVPE
AFLVFTSRATIHRISLETTNNDVAIPLTGVKEATALDFDVASNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRSFMDGTSCATLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSDMLGQDRVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGQCEQLCLAVPGGHRCGCASHYTLDSSGRNCSPP
TTFLLFSQKNAINRVVPDDPHSPDLILPLHGLRNVKAVDYDPLDRLLYWVDGRQNIKRAR
DDGTQPYILTAPGQNQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRG
DRDRPRAIVVNSERGYLYFTNMQDRTARIERAALDGTEREVLFTTGLIRPVALVVDNSLG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLAALGSHIYWADRQQQMIERVEKTT
GERRTRVQGRITHLTSIHAVEEVSAEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACSTGEIDCIPAAWRCDGFPECDDQSDEEGCPVCSAAQFP
CERGQCVDLRLRCDGEADCQDRSDEADCDAICLPSQFRCASGQCVLIKQQCDSFPDCVDG
SDELMCEITKPSTDDTPTHSSAIGPVIGIILALFIMGGVYFVCQRVVWQRYTGATGPFPH
EYVSGTPHVPLNFMAPGGVQHSAFTGISCSKSMMSSVTLMAGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPAAVRPYRPYILRGVAPPTTPCS
TDVCDSDHSASRWKTSKYYPDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSSFHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_006893302.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]