SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006900960.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006900960.1.29581
Domain Number 1 Region: 52-290
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-90
Family Calponin-homology domain, CH-domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 2417-2533
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 307-427
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1576-1732
Classification Level Classification E-value
Superfamily Spectrin repeat 3.07e-29
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 436-538
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-22
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 6 Region: 1897-2053
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-22
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 858-989
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 1735-1838
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-20
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 1261-1413
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-19
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 10 Region: 529-651
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-18
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 751-846
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 12 Region: 1094-1209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000072
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 1413-1526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000134
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 14 Region: 2055-2117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000345
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 15 Region: 651-780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000177
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006900960.1.29581
Sequence length 2574
Comment PREDICTED: spectrin beta chain, non-erythrocytic 4 [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MAQVPGGEVDNMEGLPAPNNNNNNPTARWESPDRGWEREQLAASTAAASLFECSRIKALA
DEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLSGEQLPRPTRGRMR
IHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDN
RETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSN
ANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKR
IGKVLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCT
LEKPVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAA
LRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEA
DIAAYEERVQGVAELAQALASESYYDSRRVTAQRDSVLRQWALLTGLVGARRTRLEQNLA
LQKVFQEMVYMVDWMEEMQGQLLSRECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNA
AALRFSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRTELEASRSLWALLQELEEA
ESWARDKERLLEAASGGGGAGTGGAAGAAGNAGGAHDLPSTARLLAQHKILQGELGGRRT
LLQQALRCGEELVAAGGAIGPSPDTVLLAGLAERAASARRRWQRLEEATARRERRLQEAL
ALHQFGADLDGLLDWLRDAYRLAVAGDFGHDEASSRRLARQHRALTGEVEAHRGSVGGLR
RQLATLGGASGAGSLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHAC
ELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQKLVEGGHP
SSDEVRSCQDHLNSRWNRIVELVEQRKEEVSAVLLVENHVLEVAEVRAQVREKRRAVESA
PRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAARFPAQEARLRKGAEELGTEWGAL
ASAAQACGEAVAAASRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPGSLEEADALLTRHA
ALKEEMDQREEDYARIVAASEALLASDGAELGPGLALDEWLPHLELGWHKLLGLWEARRE
ALVQAHVYQLFLRDLRQALAVLRNQEMALSGPELPGTVESVEEAVKRHRDFLTTMELNQQ
KMQVAVQAAEGLLRQGNVYGEQAQEAVVRLLEKSQENQLRAQQWMQKLHDQLVLQHFLRD
CHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQTFMAELAQNKEWLEKIEREGQQLMQE
KPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQL
QDVDPGGDLATVNSQLKKLQSMESQMEEWYREVGELQAQTAALPLEPASKELVGERQTAV
GERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQH
MKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRSGLEQLRGAWAGLREAAERR
QQALDAAFQVEQYYFDMAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENY
EESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLS
RQVDELEHWIAEKEVVAGSPELGQDFEHVTVLQEKFSEFASETGTAGRERLAAVNQMVDE
LIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEK
RRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAI
ASREQEVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIASQIGAADKPRD
VSSVEVLMNYHQGLKTELEARMPELTACQELGHSLLLNKSAMADEIQAQLDKLGTRKEEV
SDKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAF
RKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPAGY
EKGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEVSVRVEPTSPPAVPED
TPETPRTPPPAVEPDRSRPERQESTDRAQELPRRRRPERQESADQPEEAARRRRPERQES
TEHEAAHSLTLGRYEQMERRRERRERRLERQESSEQETPPRGDLVKGKATLADIVEQLQE
KEAGPGLPAGPSLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEG
GGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVNLYCVLSKG
ELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDE
EEMNGWLEAVAASVAEHAEIARWGQTQPTTSSTDEGNPKREGGERERRASGRRK
Download sequence
Identical sequences XP_006900960.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]