SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006915186.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006915186.1.64745
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-94
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 2173-2294
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 600-741
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1532-1686
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-28
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-27
Family Spectrin repeat 0.00000428
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 815-948
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-24
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 10 Region: 1690-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 2.72e-18
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 14 Region: 2011-2069
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000059
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 15 Region: 1388-1476
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006915186.1.64745
Sequence length 2331
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X1 [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGQETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRNELIRQEKL
EQFARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRARRQRLEMTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTEEKEY
QPCDPQVIQDRVSHLEQCFEELSNIAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLNQIFQEAEGMVAHKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGLDEGATRA
LGKKHKEFLEELEESRAAMEHLEQQAQAFPQEFRDSPDVTNRLQALRELYQQVVAQADLR
KQRLQDALDLYTVFGETDACELWMSEKEKWLAQMEMPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNHAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSEQRETVSSALRVHNYC
VDCEETSKWIVDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVAAIQARVGALERESKQ
LMESHPEQKEDIGQRQAYVEELWQGLQQALQGQEALLGEASQLQAFLQDLDDFQSWLSMA
QKAVASEDMPESLAEAEQLLQQHAAIKDEIDRHQDNYEHVKASGEKVVHSQTDPEYLLLG
QRLEGLEAGWDALHRMWESRGRTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLFSDKIKEKVQLIEDRHSKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFMA
ELASHQGWLNSIDAEGKQLMEEKPQFEARVSQRLEALHRLWDELQATTQEKAQRLSAARS
SDLRSQTHADLNKWISAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVTVRKEELGELFA
QMPSLGEEGEDMDLGIEKQFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSANYGTNLQTVQLLMKKNQTLQNEILGHAPRVEDVLQRGRQLVEEAEIDCQDIKQRLG
HLQGSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAESWISEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
DRRRKLENMYHLFQLKRETDDLEQWITEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
SIGQERVDSVNAIIERLIDTGHEEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGMQVQQFQDVAT
RLQTAYAGEKADAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWLE
NIIRQIDTQERPRDVSSVELLMKYHQGIKAEIETRSKNFSACLELGKSLLQRQHEASEEI
REKLQQVVSRAKEMDEKWTARWEQLRILLEVCQFSRDASVAEAWLIAQEPYLASQDFGHT
VDSVEKLIKRHEAFEKSTASWAERFDALKRPTTLELKERQILEEPLAEETGPQEEEGETA
GEGPRSYHQAATERTSPGEEERQWPRDLPPPPPPGPREQGQEKSGEDERPSTEPLFKVLD
TPLSEGDEPATLLAQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTF
YKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRIKAQSLPLPSITGPDASLSKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006915186.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]