SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006973203.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006973203.1.50099
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 2174-2293
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-33
Family Pleckstrin-homology domain (PH domain) 0.0000208
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-33
Family Spectrin repeat 0.0000925
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-28
Family Spectrin repeat 0.00000403
Further Details:      
 
Domain Number 6 Region: 1851-2006
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 639-742
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-25
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 8 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 4.11e-25
Family Spectrin repeat 0.00085
Further Details:      
 
Domain Number 9 Region: 1532-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 10 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-24
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 3.04e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 520-640
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-19
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000419
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006973203.1.50099
Sequence length 2330
Comment PREDICTED: spectrin beta chain, erythrocytic [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTINVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHS
IDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFTEGKGY
QPCDPQVIQDRVNHLEQCFGELSNMAAGRKVQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLLLQRKHKAFEDELRGLDAHLKQIFQEAEGMVAQKQFGHPQIENRVKE
VSAQWDHLKELADFRKKDLQNAEDFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLESQAQGFPEEFRDSPDVTSRLQTLRKLYEQVLAQSILR
GQRLQDALDLYTVFGESDACELWMGEKEKWLNQMDIPNTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYC
VDCEETSRWIMDKTKVVESTKELGQDLAGVIAIQRKLSGLERDVLAIRDRVSALARESQY
LMESHPEQKEDIGRRQVDVETLWKGLQDALQGQELSLGEASKLQAFLQELDDFQTWLSMT
QKAVASEDMPESLPEAEQLLQQHAAIKEEVDAHKDKYHQVKASGEKVIEGQSDPEYQLLG
QRLEGLDAGWDALWRMWESRGHTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
AAAEAGIRKFEDFLVSMENNRSKVLSPVDSGNKLVAEGNLYSDKIQEKVQLIEDRHKKNS
EKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMA
ELASHQGWLENIDAEGRQLMAEKPQFTDVVSERLDALHKLWDELQTTTKAKTEQLSAARS
SDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKRVEDQVNLRKEELEELFA
DAPSLGAEAGDTDVSIERRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPL
AQSADFGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGRQLVEAAEIDCQDIEERLG
RLQGSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAI
VMLKRHLRQQRTVEEYGRNIKQLAARAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETG
AIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLN
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADAIQGKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASEEI
REKLQQVVSRRQEMNDKWEARSDRLQMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAG
EAPQVHHAATERTSPGEERGTWPHDPQPPPLPGGHHKEEQEKSAGDERPATEPLFKVLDT
PLSEGDEPTTLPAQRDLGHTVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSQLTFY
KDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLS
WLQGMSTAINESQSIRVKAQSLPLPSLAAPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006973203.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]