SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006985582.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006985582.1.50099
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-64
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006985582.1.50099
Sequence length 108
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1A [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Download sequence
Identical sequences A0A091CR06 A0A2K5DDT7 A0A2K5IH40 A0A2K5MQ73 A0A2K6AAW4 A0A2K6KNF4 A0A2K6N9A7 A0A2K6UI29 G5AV72 G7MS52 G7PXP4 H0WL54 H2P1G2 K7AVT2 P62942 P62943 U3F425
ENSOGAP00000002355 ENSPTRP00000022531 HGL_H00000371161 5gky_B 5gky_D 5gky_F 5gky_H 5gkz_B 5gkz_D 5gkz_F 5gkz_H 5gl0_B 5gl0_D 5gl0_F 5gl0_H 5gl1_B 5gl1_D 5gl1_F 5gl1_H NP_000792.1.87134 NP_000792.1.92137 NP_001164597.1.1745 NP_001244183.1.72884 NP_001271692.1.63531 NP_463460.1.87134 NP_463460.1.92137 XP_001167897.2.37143 XP_003779368.1.23681 XP_003802673.1.62490 XP_004061713.1.27298 XP_004585744.1.84141 XP_004840714.1.39548 XP_005363223.1.66349 XP_006985582.1.50099 XP_007960958.1.81039 XP_008832446.1.79516 XP_008993872.1.60252 XP_010350063.1.74449 XP_010359608.1.97406 XP_010611194.1.5607 XP_011708918.1.29376 XP_011798780.1.43180 XP_011829653.1.47321 XP_011829654.1.47321 XP_011907735.1.92194 XP_012310709.1.9421 XP_012367351.1.23891 XP_012367352.1.23891 XP_013207702.1.66349 XP_017371030.1.71028 XP_017751216.1.44346 XP_017751217.1.44346 ENSMMUP00000021038 ENSMMUP00000021628 gi|17149836|ref|NP_463460.1| gi|4503725|ref|NP_000792.1| ENSP00000371134 ENSOGAP00000002355 ENSP00000371138 ENSP00000383003 9544.ENSMMUP00000021628 9544.ENSMMUP00000037652 9600.ENSPPYP00000012122 9606.ENSP00000371138 d2nd5a1 d3mdyb1 d3mdyd1 ENSPPYP00000012122 ENSMMUP00000021628 ENSMMUP00000037652 ENSPPYP00000012122 ENSNLEP00000011403 ENSP00000371138 ENSP00000383003 ENSPTRP00000022531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]