SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006997265.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006997265.1.50099
Domain Number 1 Region: 17-204
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.96e-69
Family Ribosomal protein S7 0.00000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006997265.1.50099
Sequence length 204
Comment PREDICTED: 40S ribosomal protein S5 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKR
FRKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSG
PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINA
AKGSSNSYAIKKKDELERVAKSNR
Download sequence
Identical sequences A0A061HTF9 A0A1U7R614 B0BN81
10116.ENSRNOP00000026528 NP_001264172.1.100692 NP_001264172.1.4139 XP_005086780.1.91757 XP_005361146.1.66349 XP_006166785.1.99106 XP_006997265.1.50099 XP_007636753.1.28591 XP_008820997.1.79516 XP_021513318.1.76796 XP_021513319.1.76796 ENSRNOP00000026528 ENSRNOP00000026528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]