SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007000957.1.33187 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007000957.1.33187
Domain Number 1 Region: 633-708
Classification Level Classification E-value
Superfamily EF-hand 0.00000146
Family Polcalcin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007000957.1.33187
Sequence length 740
Comment hypothetical protein TREMEDRAFT_41814 [Tremella mesenterica DSM 1558]; AA=GCF_000271645.1; RF=representative genome; TAX=578456; STAX=5217; NAME=Tremella mesenterica DSM 1558; strain=Fries; AL=Scaffold; RT=Major
Sequence
MLSSRAGPSGTHWNVVTRPIRNVPNVTSGRRSKASFSSHSSSILYAATTNTLSIRTFNSR
RLPSAISLVALDPSSFRSARDSRYITTEPTRTAQPSVPPPAAPLTKSIQDDTEVKGVPPP
GSPPPTPPLPISAIPPKIAEVAEKEAKEVKKKEEPKGSLPSRVWTTVKKEAQHYWQGTKL
LGQEIKISSKLQWKVLNGGTLTRRERRQLRRTTTDLLRLLPFSVFVIVPFMEFLLPIALR
LFPNMLPSTFEGEFAAAEKQRKLLRVRIEMAKFLQETVRESGLKADAVVKSDEFKQFFRK
VRSTGETPSQADVVRVAKLFHDDITLDNLSRPQLVSMCKYIGINAFGTDNLLKHQIRNRL
EKVRVDDMMIHAEGVDSLSTKELQQACQSRGIRFQGVSPARLREELEQWIDFHYINGISG
VLLVLSRAFNFESKGDNVMGALITTLSSLPENLINEAELHVAEDATFRQKLEVLQQQQEL
IEDEAEQEQKEVEARKADEAAKKEAEAAKKEAEVAAKEAEEPEKTEQPTTEPEAAAKVAK
VEEETAAAAAAAAAEDARMTKEQLGELAEALNILTAKSSIVKERDELAALLEDNLLSEAE
SKERPDETDQASIAVSKRVRSMIKKIDTQLEKYDEKVGSSLNVIQTNVKGQISLADLERA
LRVIKHAPPEEAIQGLGKKLDVDSDGFVELDHVVELTQDRGLGITPEDAAAKDILSSGKD
IRQKDIKQLKPKREDIVADE
Download sequence
Identical sequences jgi|Treme1|41814|estExt_Genewise1Plus.C_11023 XP_007000957.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]