SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007002035.1.33187 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007002035.1.33187
Domain Number 1 Region: 83-194,225-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 654-740
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000128
Family Calmodulin-like 0.035
Further Details:      
 
Domain Number 3 Region: 323-418
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000353
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007002035.1.33187
Sequence length 781
Comment hypothetical protein TREMEDRAFT_70788 [Tremella mesenterica DSM 1558]; AA=GCF_000271645.1; RF=representative genome; TAX=578456; STAX=5217; NAME=Tremella mesenterica DSM 1558; strain=Fries; AL=Scaffold; RT=Major
Sequence
MFRRPSRRIFISGTAAITGLSLTYLLIRPQPLQLDSDDPVNRQKQKQRQRPGPLWSPPSR
AQMIGHLRTSGVHGTGVDSEDIFDLLIVGGGATGAGTALDAASRGLKVACVDRDDFASGT
SSKSTKLVHGGVRYLQKAIMGLDYEQWKLVKEALRERKVFLETAPHLSFMLPILLPIYTW
WQLPYYYIGCKMYDFLAGKENMESAYWMGKGKSLEAFPMLKKEGLVGGVVYYDGQHNDSR
MNISLVMTAVQHGAIMANHVEVTELHKRPDSKRDGQERVCGARLRDRMTGEEWSVRCRGV
INATGPFSDGIRKMDEPTTMEIVAPSAGVHITLPNYYGPKTMGLLDPATSDGRVIFFLPW
QGNVIAGTTDSPTTVSQNPIPKEEEIQWILDEVRGYLSSDVKVRRGDVLSAWSGIRPLVR
DPGAKNTQSLVRNHMINISKSGLLTIAGGKWTTYRAMAEETVDAAIKEFNLPTTGPSQTD
HIKLVGGHAWSKTMYIKLIQQFGLETEVAKHLAESYGDRAWVVASMSEKTGLTWPLLGVR
LSPLYPYIEAEARYACRFEFAQKATDFVARRTRLSFLNTQVTLEVLPRVIDIMAEELGWD
KKRKAKEFYETVEFLKSMGLQDASKLTYEQAVKNQGKIGLLGLTKMTDAALHSRAQFTPD
EVAHLRQQFEALDFDNDQKITRADLSQAMTRMGYDASTETADNILREVDFGRKGAIEFQE
YLDIAAGLKELQLENAFTHLAQLDTSRKIGGHDPAGYQAQSGGSRREDRRKIPVERSGGG
T
Download sequence
Identical sequences XP_007002035.1.33187 jgi|Treme1|70788|estExt_fgeneshTM_pm.C_10372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]