SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007007988.1.33187 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007007988.1.33187
Domain Number 1 Region: 1706-1921
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-52
Family DBL homology domain (DH-domain) 0.0000282
Further Details:      
 
Domain Number 2 Region: 210-311
Classification Level Classification E-value
Superfamily EF-hand 5.91e-28
Family Eps15 homology domain (EH domain) 0.0022
Further Details:      
 
Domain Number 3 Region: 1231-1288
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 986-1007,1169-1229
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000276
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1939-2036
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000456
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007007988.1.33187
Sequence length 2048
Comment hypothetical protein TREMEDRAFT_74832 [Tremella mesenterica DSM 1558]; AA=GCF_000271645.1; RF=representative genome; TAX=578456; STAX=5217; NAME=Tremella mesenterica DSM 1558; strain=Fries; AL=Scaffold; RT=Major
Sequence
MQPWQQQQQQQQYPYNAFPPQPTGFQPQPTGYLQSAQTGFRPPPQQPQPQGNLSFLNQPP
PQQTNLSFLNQPPSSFRPSGLNPQQTGFPGGGASGLSSQPTGYPGGGASGLLPQQTGFPG
GGVSGLLPQQTGFQPGLLSQPTGLMPQQTGFLRAQPTGFYDTRLQTMTQSFMPSNLSQPF
APSGVPQFNPTPNAQPLTQAFQSLLQNPSVKTPKVPWALSRQEKKDYDQIFRAWDVKGDG
FITGEMAREVFGQSGLGQDDLMKVWNLSDVSNRGKLNLPEFHVAMGLIYRALNGNDIPDT
LPEELVPASMRDIDTTVNFMRDLLKHESSARSNASSPSYGSSIPGPASKDATMYKHDDNR
PSGYKPSSRHLDRKSVRYAGEESAAEIGDIRRQLANTSALLDQRNDEYSRRSAEDEELEA
EKEDIRRRVRRIQEDIEYVSKGRKTVEKDEERRKLEREMLFLMHEKLPELERKENQREED
KRREERAGVRARDKRNESHGRYGYEDDRGSDWLRGSYDRRDRSRERERDRDRDNYHNDRD
RNHDRYDRRDSDGYGRSSERSRDREYDRNGSRDSRPRSPPAVRSPPPAPPAPSIAAPPPP
PAPTSTAAAPSTKNMTPEQRSAFIREQAQKRIQDRLRALGVESAPPEQPVVDKSVEERLE
REKKEAEAKSASAEKDLEAREEARRQRLGLSTPSVSTESPTTPVSTAPPPPAPPASRAPA
SPAPLRSAMKKPAAPPAPPSRKGPPAPVTRAPAVSAPPAPPAPVAASRPDEDPEEVELRQ
REEARQKAIADRRARLAQLEKEEEEERKKEEALLAARQSRQTVASPIKPPVAPPAPAPPE
APAPSHAASNEGSYNPFRKPGAAATPGASSTPVASGGGFNPFFKPQATPAAASPPSDAAP
PPQPPTPPAPPPQTAPTASATSFAPSSRSTPVQKEDEWDVIQEKEEADSDSDSDSDYAHS
RNKRGALASALFGGILGGVTSPSTSRPSSTAPASAPPPPPPPPAPAPPAALANLGGGDPT
AGRGALLSAITGGAKLRKAQTVDKSIVQGAGAVLGDAAPPSHINTTPSLPSPTRTSASVA
KDLPSQNNFDAKNAPMEDHQDRENGDEDEYKLRNLNRQSVDWYAGLAADVHANGNGYDGS
GLSSTAEEEEVKENGHAGDELDEFDLTKTIRVRSMYAYEGQRDVDLSFKENVVIEAHPAK
DASSDWWYGTLINEAKTGWFPHSYVEEIHAVQAKALYPYEGTTPEELPFLADDILLVVDH
SEPDWWKVEKAGTIFLVPASYMTLMVPTAERRVDGEVSPSATFPAPSHPLPPHDVLSSSS
NPKHILPPTSDHDISSEGNPSDDHFATSSLGRGRSPSILSVSSSSSSDSVLSFWSSDASS
ISDLESNEERQEERRQKEDEKKRREIERSKIMDAAGLKLRREPPGVPIRPSERTRRRPPP
APGRDKVHHDYDSLPSHTVGGAVPILAQTGNNATVDVIGLDMDRNGNVSKGGSRRAAPAI
PSRPTSMFDTVADVKTSHRNRLSDSQIHTQTPSIQVKDVDERTFDTRQETNDYETNTALF
KYTNNSEKISPQQDKFEGQATQDAYARYEKYLASTLSAPSPRRPRSNSRLSIQTTGTPTL
TTLGDRVTSPPSHLTQSRLTGLLAWMKTTSADRKSPLPMISGPISLDENHPSHIATVQGF
DDGDGNRDGEMLDGERGRMDGEVGKTWSSLVEKDLLDSMSERERKRQEAIFEFIATEIGY
NRDLQVVVEVFYAGLMTRIPDHLETIFTNIQDLLLTNTGFLSALEQRQKSCRLYVDTIGD
ILEDWMPAMGGYMTYCVNQHRAARELIVLRESDEGLAGWLDKMREEEGLVRGLDLSSFLL
IPMQRITRYPLLLKQILHYTEPDQDISSVERALRIVESIVARINEGIREVEGQETLKMLS
EDLWVGGEGRLDLTAPTTFLGPRRLLKEGQVTKAKSGRKLTLVLCNDILVLIESRNLYRM
PIPLHEVSLRHAKDDSFALKVDYRRGDDTIRLRATSARQAQEWVQLITAARTRAIEARRN
GGGVEYPM
Download sequence
Identical sequences R7SD96
jgi|Treme1|74832|estExt_fgeneshTM_pg.C_160129 XP_007007988.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]