SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007033652.2.67643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007033652.2.67643
Domain Number 1 Region: 283-384
Classification Level Classification E-value
Superfamily TAZ domain 4.71e-24
Family TAZ domain 0.00043
Further Details:      
 
Domain Number 2 Region: 88-171,207-236
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000012
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007033652.2.67643
Sequence length 418
Comment PREDICTED: BTB/POZ and TAZ domain-containing protein 3 isoform X1 [Theobroma cacao]; AA=GCF_000208745.1; RF=representative genome; TAX=3641; STAX=3641; NAME=Theobroma cacao; cultivar=B97-61/B2; AL=Chromosome; RT=Major
Sequence
MIQDIWEEVYLMASLAIDSAWLPSPSESLCRSLNVCVEEANPADILPALEAPMSSVSDNC
NIPKPPPLPSKVRTRTKYSKRPLECSLVPKETKNTWDKLFKEGYGVDVCIITKDKSCVLA
HSNILSIASPVLSNILSRSKVKHGMRYIKIPGVPHDAIFMFIRFLYSSCYEEEELRKFVL
HLLVLSHSYSVLPLKRVCICLLEQGWLTRENVIDVLQLAKNCDAPRLAFICVRMIVKDFK
SISSTEGWKVMKRANPALEQELVESVVEADSRKQERQRKMEEKKVYLQLYEAMEALLHIC
KDGCRTIGPRDKVLKGSQVTCNFPACKGLETLVRHFSNCKTRVPGGCVHCKRMWQLLELH
SRMCNEPDSCKVPLCRHFKEKMQQQSKKDETKWKLLVSKVIAAKNAVGSFSSRRSCLS
Download sequence
Identical sequences XP_007033652.2.67643 Tc04_g017120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]