SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007040282.1.67643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007040282.1.67643
Domain Number 1 Region: 17-102
Classification Level Classification E-value
Superfamily POZ domain 2.75e-16
Family Tetramerization domain of potassium channels 0.006
Further Details:      
 
Domain Number 2 Region: 127-444
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000212
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007040282.1.67643
Sequence length 469
Comment PREDICTED: BTB/POZ domain-containing protein At5g41330 [Theobroma cacao]; AA=GCF_000208745.1; RF=representative genome; TAX=3641; STAX=3641; NAME=Theobroma cacao; cultivar=B97-61/B2; AL=Chromosome; RT=Major
Sequence
MSSFGMQCLETEPELNSNVVTINVGGQIFQTTKQTLTQGGPKSLLSQLAETTSKRFVDRD
PDYFSLLLSLLRSGTLPSKVKDFDLHDLIEESRFYGLESLLNNSLTNPSHFDAFALQKSL
ILPLNGRDSPSTIATTPSGTVHVAHGSKITSFDWSLTRKSTILTQFTAVDSLLAISPDIA
AAGATDFSGLQILDLQNGSVKQVLNWENVTRSGSTVQAIGSSSEFLFTSFESGRRNSNSI
MVYDLNTLNPVTEIGHNEIFGADLDSAIPATKLRWVTGYGLVMASGSHSGLSGVSGNIKF
WDIRSGNVVFELKEKDDCFSDVCVSDNLNAIFKVGVNSGEVFYTDLRSLGSVSDDANDNS
NPWICLGNSRKVVNGKKEGYGCKIESHGNQVFCSKGGDIELWSEVVMGSAKISEGPLKER
RVFRKNLMGRVKDLGGLRITNLAFGGNRMFVIRKDQQAVEIWQGSTRGI
Download sequence
Identical sequences A0A061G5W2
CGD0015991 Tc03_g027620 XP_007040282.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]