SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007056798.1.26238 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007056798.1.26238
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-56
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-40
Family YWTD domain 0.0000523
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-28
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1170-1206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1092-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 739-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000387
Family EGF-type module 0.027
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000155
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007056798.1.26238
Sequence length 1453
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Chelonia mydas]; AA=GCF_000344595.1; RF=representative genome; TAX=8469; STAX=8469; NAME=Chelonia mydas; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGETLYWTDWQTRSIHACDKRTGEKKREILNALYSPMDI
QVLSPERQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGKTCKAGAEEVL
LLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDG
SGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGENPKIECAYLDGSERRVLVNSSLGWPNGLALDLEEDKLYWGDAKT
DKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIRASRDIIIDQ
LPDLMGLKAASVTKVFGTNPCAENNGGCSHLCFFTPLETRCACPIGLELLSDMKTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDISLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPR
SLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTNGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMQNNGQCGQLCLAIPNGYRCGCASHYTLDPNSRNCSSP
TSFLLFSQKSAISRMIPDDQQSPDIILPVHGLRNVKAIDYDPLDKLIYWVDGRQNVIKRA
KDDGSQPFTVMSTPNQNPEKQPHDLSIDTYSHTLYWTCEATNSISVHRLNGEPIGTVLKG
DHDKPRAIAVNAERGYMYFTNMQERAPKIERAALDGTEREVLFSTGLIRPVALVIDNKLG
KLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKTS
GYKRTRIQGRIAHLTGIHAVEEVDMDEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPDHL
VLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSAAQFQ
CEKGQCIDARLRCNGEIDCQDKSDEADCNTICLPNQFRCASGQCILIKQQCDSFPDCIDG
SDELMCEKNTSSDEPQPHVSAIGPVIGIILSLLVMGGMYFVCQRVVCQRYAGPNGPFPHE
YVSGTPHVPLNFIAPGSSQHGTFTGKDGISCGKSMISSMSLMGGSSGAPLYDRNHVTGAS
SSSSSSTKATFYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSYRPYLIRGIAPPTTP
CSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFH
LYPPPPSPCTDSS
Download sequence
Identical sequences XP_007056798.1.26238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]