SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007056997.1.26238 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007056997.1.26238
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-27
Family YWTD domain 0.0000493
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000351
Family EGF-type module 0.008
Further Details:      
 
Domain Number 9 Region: 1174-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000245
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000553
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000404
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007056997.1.26238
Sequence length 1464
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Chelonia mydas]; AA=GCF_000344595.1; RF=representative genome; TAX=8469; STAX=8469; NAME=Chelonia mydas; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRSVIINTDIYWPNGLTLDYEEWKLYWADAKLNFIHKSNL
DGTHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACNKYSGEDLREIHSNIFSPMDI
HVFSQQRQPNATNPCGSNNGGCSHLCLMSPIKPSYQCACPTGVKLLENGKNCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SASQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYAESKIYWGDAKT
DKIEVMNADGSSRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVHQIIGANPCAEDNGGCSHLCLYRPQGPRCACPIGLELISDMRTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVTSLVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGEDDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREILFFSGLSKPIALALDS
QLSKLFWADSELRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDS
QFQCESGQCIDSIFRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKNKKCDHNLDC
SDSSDEQGCCKYTTEEPAPQANNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETM
TNDYVVHGPASVPLGYVPHPSSLSGSLPGKSGMSRGKSVISSLSIMAGSSGPPYDRAHVT
GASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRPYSYRHFAPP
TTPCSTDVCDSDYAPSRRVTTAVTKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPP
SPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_007056997.1.26238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]