SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007102354.1.24612 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007102354.1.24612
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-93
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-34
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 3 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-29
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-28
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-27
Family Spectrin repeat 0.00000403
Further Details:      
 
Domain Number 8 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-24
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-23
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 10 Region: 425-527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 7.36e-20
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-18
Family Spectrin repeat 0.00069
Further Details:      
 
Domain Number 13 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 14 Region: 1386-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000406
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007102354.1.24612
Sequence length 2107
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X2 [Physeter catodon]; AA=GCF_000472045.1; RF=representative genome; TAX=9755; STAX=9755; NAME=Physeter catodon; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLERAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALREELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELERENYHDQKRITARKDNVLRLWNYLQELLQSRRQRLEKTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTEEPGY
QPCDPQVIRDRVSHLEQCFEELSNTAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELHGLDAHLDQIFQEAEGMVARKQFGHPQIEARIKE
VSAQWNQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATQA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALRDLYQQVVAQADMR
RQRLQDALDLYTVFGETDACELWMGEKGKWLAQMDIPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANSLVESSHPRSGEVKKCQDHLNTRWQEFQTMVLERREAVDSALRVHSYC
VDCEETSKWVVDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIHARVGALEQESQR
LMESHPELKKDISQRQAYVEELWQALQQALKSQEASLGEASQLQAFLQDLDAFQAWLSTA
QKDVASKDMPESLPEAEQLLQQHAAIKDDIDGHQKSYQQVKASGEKVIHGQTDPEYLLLG
QRLDGLDKGWDALHRMWESRSHALTQCLSFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEARIRKFEEFLVSMENNRDKVLSPVDSGNKLIAEGNLYSDKIKEKVQLIEDRHRKND
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHQGWLENIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQAATQETAQYLSAARS
SDLRSQTHADLNKWIRAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVNVRKVELEELFA
QMPSLGEEAEQEDLSIEKRFLDLLEPLGRRTKQLESSRAKLQISRDLEDETLWVEERLPL
AQSTDYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLHRGQQLVAAAEIDCRDVEERLG
HLQSSWDTLRETAAGRLQRLRDASEAQQYYLDAGEAEAWISEQEFYVFSDETPQDEEGAI
VMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREVEDLEQWITEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAIIERLIDVGHAEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQ
RYFYTGAEILGLIDEKHRELPEDVGLDTSTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADTIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQEKPRDVSSVELLMKYHKGILAEMETRSKNFSACLELGESLLQRQHQASDEI
REKLQQVVSRRKEMKEKWKARQEQLHMWLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTAGWAERFAALEKPTTASRGGRRDSRGGSPRSPPSSHRENVPG
QFPVPFV
Download sequence
Identical sequences XP_007102354.1.24612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]