SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007143601.1.22112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007143601.1.22112
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-72
Family Capz beta-1 subunit 0.000000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007143601.1.22112
Sequence length 256
Comment hypothetical protein PHAVU_007G085400g [Phaseolus vulgaris]; AA=GCF_000499845.1; RF=representative genome; TAX=3885; STAX=3885; NAME=Phaseolus vulgaris; cultivar=G19833; AL=Chromosome; RT=Major
Sequence
MEAAMGLMRRIPPKHTETALSALLSLMPHHSSDLLSQVDQPLQVLCDVECGKEFILCEYN
RDADSYRSPWSNKYHPLLEDGSLPSLRLRKLEVEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTNYRLTSTVMLTLTT
DNESSGTFSLSGSIRRQMSMRLSVADGHLCNMGRMIEEMESKLRNSLDQVYFGKTREMVC
TLRPPSEVSQMRMPES
Download sequence
Identical sequences V7BDF0
Phvulv091006049m|PACid:23552701 XP_007143601.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]