SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007146732.1.22112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007146732.1.22112
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily TSP9-like 1.27e-23
Family TSP9-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007146732.1.22112
Sequence length 91
Comment hypothetical protein PHAVU_006G065100g [Phaseolus vulgaris]; AA=GCF_000499845.1; RF=representative genome; TAX=3885; STAX=3885; NAME=Phaseolus vulgaris; cultivar=G19833; AL=Chromosome; RT=Major
Sequence
MASIIMSFSPATGRVFAATAAKGAGGSKEEKGFLDWILGGLQKEDQLLETDPILKKVEEK
NGGTTTSNGRKNSVAVPQKKKGGFGGLFAKN
Download sequence
Identical sequences V7BQ66
XP_007146732.1.22112 Phvulv091007677m|PACid:23541523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]