SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007160809.1.22112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007160809.1.22112
Domain Number 1 Region: 433-534
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-23
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 213-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-22
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 3 Region: 19-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-22
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007160809.1.22112
Sequence length 559
Comment hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]; AA=GCF_000499845.1; RF=representative genome; TAX=3885; STAX=3885; NAME=Phaseolus vulgaris; cultivar=G19833; AL=Chromosome; RT=Major
Sequence
MGCDCGGKLNLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQ
LLKQDNDLFFHHGWSSFVVDHSLECGDLLVFRYEGHLHFTVQVFDKDACEKEAAFISECS
QSSSDFEAITGQKRGKDLLRYEVVRPIRMFRETEETSKACLANDALVPFHTDNRNEEAAI
MYRSGKEDGSYFLGGVSLSNVSAQDEKKVAQSFTSDYPYFVRIMKSFNVSGSYTLNIPYQ
FSMAHLPNCKIKIILHNLKGEHWTVNSVPTTRVHTSHTLCGGWMAFVRGNSITVGDICIF
ELVHKCELRVHIAGVGNDGLDCQVGRVNAGHVGPPRYMPTNAKVNSKCIRKVDVSNKKWP
KIGQETVLSIDLKKSGRASNASKHMGLCPQSKVAHKKLATPRRHRVEDELSSQAKAGLRM
LFALDEQRVAQAFSSPFPSFVKIMKKFNVSGSYTLKIPYQFSAAHLPTYKTEVILRNSRG
ECWTVNSVPDAKGRTVHTFCGGWMAFVRDNDINFGDTCIFELVTQSEMQVYISGVGKEGP
DHQNGHIKLDRLANLPSTC
Download sequence
Identical sequences V7CRR5
XP_007160809.1.22112 XP_007160810.1.22112 Phvulv091010916m|PACid:23548860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]