SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007231837.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007231837.1.101067
Domain Number 1 Region: 27-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-90
Family Calponin-homology domain, CH-domain 0.000000921
Further Details:      
 
Domain Number 2 Region: 2159-2274
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-36
Family Pleckstrin-homology domain (PH domain) 0.0000042
Further Details:      
 
Domain Number 3 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.0000227
Further Details:      
 
Domain Number 5 Region: 1633-1787
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 590-729
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-28
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 1526-1682
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1845-1999
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 803-938
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-25
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 11 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-23
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 12 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 13 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-18
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 14 Region: 733-835
Classification Level Classification E-value
Superfamily Spectrin repeat 9.28e-18
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 15 Region: 2004-2065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000187
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007231837.1.101067
Sequence length 2335
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X2 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
METEWGSGSDLYQGAGFPAQMPFNYNQLDGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVARELEAENY
HDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLS
QDYGKHLLGVEDLLQKHALVEADIGIQADRVRNVNSNAQKFAIDDDGYKPCDPQVIRDRV
AHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDVGKDLTGA
VRLLSQHRALEDEMSGRAGHLQHTVREGLAMADAGHFGETRIRERVAEVQAQWAALEQLA
AVRKARLEEACGLHQFQADADDVDAWTLDALRIVSSGDVGHDEFSTQALVKTHKDAAAEV
ASYRPVIDALHEQSRALPPELAESADVSGRLAGIEERYKEVAELTRLRKQALQDALALYK
MFSEADACEVWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIRE
KTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLKGEAERLAGEHPEQAKAI
TGRLAEIDSVWEEMKDTLRNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNT
LAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINSVVEAGRRLASDGNINTDRIQERAASIDERHKKNREAAVELLMRLKD
NRDLQKFLQDCQELSLWTNEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKI
EKEGMQLVAEKPETEAIVKEKLSALQKQWQELESTTQTKAQCLFDANKAELFTQSCADLD
KWLGGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRKREVEELQSQAHVLRQEGKDT
DEVDGRREVVEKKFQEMLDPLMKRKNFLMASREIHQFNRDVEDEILWVEERMPIATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKEDSPSVEAIKARLSDLQTLW
DLIIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVTMLKKH
QILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKL
DERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQER
VDSVNRMADELINAGHTDAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDA
KEILSRILDKHKMLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAY
AGDKADDIQRRETEVLDAWRNLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLI
EAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKDKLLQ
LTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREMGQSVDDVEK
LIKRHEAFEKSAATWEERFSALERLTTMELLEVRRQQEEEERRRKPPTPEPEEIQEQRDG
EQIAQNGLPSDQDSPRDGVDGEIVNGVPERSSKEPSPIPSPTSGRRTKGSQSSTLPAKGQ
DSPSAQLEGLLHRKHEWEGHNKKASNRSWHNVYCVINNQEMGFYKDNKNAGQGIPYHNEI
PVSLKDAVCEVAVDYKKKKHVFKLRVTDGNEYLFQAKDDEEMNTWIQAIQNATTGSSASD
KSEITPSNQSTPVSSRAQTLPATVTLTTESSPGKREKDKEKDKEKRFSLFSKKKQ
Download sequence
Identical sequences XP_007231837.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]