SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007255410.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007255410.1.101067
Domain Number 1 Region: 244-338
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.89e-24
Family Ras-binding domain, RBD 0.0000136
Further Details:      
 
Domain Number 2 Region: 973-1073
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-23
Family PDZ domain 0.0000349
Further Details:      
 
Domain Number 3 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 4 Region: 386-483
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.07e-21
Family FHA domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007255410.1.101067
Sequence length 1883
Comment PREDICTED: afadin isoform X6 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKD
DREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPD
GDDHALNREDGDSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGR
PDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHS
DDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKSDERMGPLHGSL
PPEKLPYLVELSPGRGNHYAYYGYRQHEDGSDSRDKPKLYRLQHSLTEVGSDRSEDGNIQ
LFGPGILPHHCNLMHADGLVMVTPVSMDAETFVDGQRIQDTTVLRSGMTLQFGAAHVFKF
VDPSYDHVMAKRDPGPMVKGRNKSGSVPETTFDLHGDVHSGTALPTSKSSGKLDMDRSGN
GSERGMVKPMIRGEQQDFSKHDGRPHDGPELTLPASIEFRENSEDAFLSAIINYTNSSTV
HFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQEIADGDQKQ
KNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNY
MPAFLDDPEEQNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNK
LVTESDSGLCSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQ
DVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREV
QLEEDPDLQLPFLLPEDGYSCDVVRNIPNGFQEFLEPLCQRGFCRLTPHPRSPGTWTVYF
EGADCDSHFSTDNSELPMRKEPEVVTVTLKKHNGMGLSIVAAKGAGQEKLGIYIKSVVKG
GAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLL
NQPSPMMPRASDRGRGDKGKARPKSEGFELYNNSVQNGSPESPQGAWDTYPEPKREDRLL
KNRADHRSSPNVANQAQSPGGKSAYPGAPGKITSVSTGNLCPDEEPSPPRPEAYPIPTQT
YPREYFTFPASKPQDRMGPGSGQPWQSNEPEPLPPMDDHHHNSMAMQRVARSQEELCDPP
VGYPADRLPERLRQEDLRLLQQQREAEYQRDRVAGEHWNHQVSSSVESSTSSQEHLNYSS
SSSGTKPQSNHKSGAGRWKTPIGPHSGPVGVSQPSRTDLPPPPPPPPPALYDYEPQTELP
LPPPPAISQQQQQAMADRKKREEQQRWYEKEKARLEEERERKRREQERKLGQIRNPMGPP
PALHNNQHGPTLPPAPQHQQMPPPQPPVSMQLPQPYLPQPQQPPQTQPPRPEKLSTLPRA
PPPPSQPLDTVIRDLQPQQQPRTIERRDLQYITISKEELSASDSLSPDPWKRDAREKLEK
QQQMHIVDLLDKEIQELQAKPERTAEESDRLRKLMLEWQFQKRLQESKQSEEDEEEEDDE
DVDTMLIMQRLEAEKRARQQTAVPAISVLDLLQDEERRRKQQLEEIRKREAEERAKQEEE
RRWREEERARRETDEKRRQEEEYYTRLEAERRRQHDEAERKLLTPDEPGLYRPPLPRDYQ
PPLPAPATNNNSSSISNNSNPPPTPPQRNTSYLKTQVVSPDTLYTAKFVSYNDEEEEDAG
VAGFNSYTGNTTTGVVGSGEVYKDPREKSTGKGGQEQENSIGGAPENLTFKERQRLFSQG
KEVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences W5LEY9
XP_007255410.1.101067 ENSAMXP00000018401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]