SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007435863.1.37977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007435863.1.37977
Domain Number 1 Region: 621-876
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 10-269
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 320-558
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-50
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 4 Region: 924-1184
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000405
Further Details:      
 
Domain Number 5 Region: 878-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1315-1353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 576-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000227
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 1236-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 272-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000382
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1194-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007435863.1.37977
Sequence length 1602
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Python bivittatus]; AA=GCF_000186305.1; RF=representative genome; TAX=176946; STAX=176946; NAME=Python bivittatus; AL=Scaffold; RT=Major
Sequence
MCFSYSKASPLLLYANRRDLRLVDAADVTENATVVVGGLEDAAALDFVFVRGLIYWSDVS
EEAIKRTEFNQSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKV
LFWQELDQPRAIALDPARGFMYWTDWGEMPKIERAGMDGLSRSVIINADIYWPNGLTLDY
EEQKLYWADAKLNFIHRSNLDGTHRQAVIKGSLPHPFALTLFGDTLYWTDWTTRSILACN
KYTGQNLREIHSNIFSPMDIHVFSQQRQPSAANPCRNNNGGCSHLCLMSPIKPFYRCACP
TGVKLLENKKTCKDGAMELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVE
GYIYWTDDEVRAIRRSFLDGSASQFVVQAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTR
LNGTMRKILISEDLEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGW
PNGLALDYIENMIYWGDAKTDKIEVMNTDGTSRRVLVEDKLPHIFGFTLLGDYIYWTDWQ
RRSIERVHKRTAERETIIDQLPDLMGLKATNVHQIIGTNPCAESNGGCSHLCLYRPQGLR
CACPIGLELLSDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDV
TDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEV
SKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERSTLVPNVG
RANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQYQDYIYWTDWS
RRSIERANKTSGQNRTIIQNHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPIGG
FVCGCPAHYSLNPDNRTCSAPTSFLLFSQKNAINRMVIDELQSPDIMLPIHSLRNVRAID
YDPLEKQLYWIDSRQNIIRKSQEDGSQSFTVVMSPVPNQNTDIQPYDLSIDIYSRYIYWT
CEATNVINVTRLDGRGMGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSSPKIERAALDG
TEREVLFSSGLSKPVALAIDSHLGKLFWADSDLRRIESSDLSGANRVVLEDSNILQPIGL
TVFEKWLYWIDRHQQMIEKIDMTRQEGRTKVQARIAQLSDIHAVKELNMQEYRQHPCSQD
NGGCSHICIIKSDGTTRCSCPMHLVLLEDELSCGEPPTCSPQHFTCYTGEIDCIPVAWRC
DGFTECEDASDEKNCPVCSDSQFQCESGQCIDATLQCNGEPNCQDNSDEEKCEVRCLTDQ
FRCVNGQCIGKSKKCDHNLDCYDSSDEQGCYTTEEPAPPATNTIGSIIGVILTVFVVGAM
YFVCQRVLCPRMKGDGEAMTNDYAVHGPPSVPLGYVPHPSSLSGSLPGMSRGKSVISSLS
IMAGSSGPPYDRAHVTGASSSSSSSIKGAYFPPILNPPPSPATEDSRYTMEFGYSSNSPS
THRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVMTMGGKGYASDLNYDSEPTPPPP
TPRSQYLSAEENYESCPPSPYTERSYTHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_007435863.1.37977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]