SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007464484.1.90284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007464484.1.90284
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily PUA domain-like 1.06e-18
Family PUA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  XP_007464484.1.90284
Domain Number - Region: 51-89
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0915
Family Hypothetical protein APE0525, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007464484.1.90284
Sequence length 182
Comment PREDICTED: malignant T-cell-amplified sequence 1 isoform X1 [Lipotes vexillifer]; AA=GCF_000442215.1; RF=representative genome; TAX=118797; STAX=118797; NAME=Lipotes vexillifer; AL=Scaffold; RT=Major
Sequence
MGKGRFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMPKKDPVKIVRCHEHI
EILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSP
GAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKT
YK
Download sequence
Identical sequences Q4G009
NP_001037702.1.100692 NP_001037702.1.4139 XP_006541598.1.92730 XP_007122107.1.24612 XP_007464484.1.90284 XP_021043721.1.100879 ENSTTRP00000006823 ENSRNOP00000061717 10090.ENSMUSP00000110768 10116.ENSRNOP00000061717 ENSTTRP00000006823 ENSRNOP00000061717 ENSMUSP00000110768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]