SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007474184.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007474184.1.35504
Domain Number 1 Region: 10-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000133
Family HkH motif-containing C2H2 finger 0.00033
Further Details:      
 
Domain Number 2 Region: 139-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000714
Family HkH motif-containing C2H2 finger 0.011
Further Details:      
 
Domain Number 3 Region: 92-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000524
Family HkH motif-containing C2H2 finger 0.0018
Further Details:      
 
Domain Number 4 Region: 212-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000223
Family C2HC finger 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007474184.1.35504
Sequence length 273
Comment PREDICTED: zinc finger protein 346 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MADMFGSNGDTAGPVGKEAVDRMIQENNHLFTDVQCKVCNAVLISESQKLAHYQSKKHAN
KVRRYTSIHKEEEFNDGKKLKLDSKQESSHGDDRDRCCAICNMTFSSPIVAQSHYLGKTH
AKNMKLKQSNSQAEVPSKLPMNAPGFSEDSSDTSDPDKFCSLCHASFNNPSMAKQHYVGK
KHKKQETKVKLMAHYGKSKDSPVTASEAGWGYPCNTCKIILNSIEQYQAHISGFKHRNHI
PGAVPILGRFPKQQYVREETVSSGDYSYFSQDS
Download sequence
Identical sequences F7BH19
ENSMODP00000006052 ENSMODP00000006052 XP_007474184.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]