SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007474600.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007474600.1.35504
Domain Number 1 Region: 1086-1127,1158-1199
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000883
Family Fibronectin type III 0.0099
Further Details:      
 
Weak hits

Sequence:  XP_007474600.1.35504
Domain Number - Region: 667-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family Merozoite surface protein 1 (MSP-1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007474600.1.35504
Sequence length 1352
Comment PREDICTED: astrotactin-2 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MADPSSPGLGLRWQLRLRLRLGSGSGRQSLLPPPPSAPAPLLPLLLLLASGPGSSASREP
DSSCRLKTVTVSTLPVLRESDISWSGGRAGAGAGAATAAAAAAAAAAAAAAGSLGSGGSG
SGGPGSPVESRLLLFVRNELPGRIAVLDDLDNTELPFFTLEMSGTAADISLVHWRQQWLE
NGTLYFHVSMGSAGQLSRATPPTLQEPSEIVDEQMHILHISVMGGLIALLLLLLVFTVAL
YAQRRWHRRRRVPQKSASTEATHEIHYIPSVLLGPQARESFRNSRLQAHNSVIGMPIRET
PILDDYDYDYEEEEQPRRTNHVSREDEFGSQVTRTLESLGQPSEEKMDFEKKAAEVTQET
VESLMQKFKESFRTNTPIEIGQLQPALRSASAGRRKRRSKSRGGIGFGRTKGNSGSEADD
ETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCVLAMVCGNQLSCPLTVKVTLHV
PEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSPWIRDLCGQRTTDACEQLCD
QETGECSCHEGYAPDPVHRHLCVRNDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTY
SLGQGLWLPVSKSFVVPPVDLSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLS
SFGPVRDCSRNNGGCTRNFKCVSDRQVDSTGCVCPEELRPMKDGTGCYDYSKGIDCSDGF
NGGCEQLCLQQTLPLPYDASSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDS
KFNDTLFGEMLHGYNNRSQHVNQGQVFQMTFRENNFIKDFPQLADGLMVIPLPVEEQCRG
VLSEPLPDLQMLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNILKILDKD
SSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGNKKELK
SMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEI
NRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIEDWCRCDLNAFDANGLPNCSPLPQ
PVLRLSPGVEPSSTVVSLEWVDVQPAIGTKVSDYVIQHKKVDEYTDTDLYTGEFLSFADD
LLSGLGTSCVAAGRSHGEIPEVSVYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLR
TACPLVDDNKAEEIADKIYNLYNGYTSGKEQQTAYNTLMEVSASMLFRVQHHYNSHYEKF
GDFVWRSEDELGPRKAHLILRRLEKVSSHCSTLLRSAYIQSRVDTIPYLFCRSEEVRPAG
MVWYSILKDTKVTCEEKMVSMARNTYGDSKGR
Download sequence
Identical sequences F6Y7H9
ENSMODP00000024460 XP_007474599.1.35504 XP_007474600.1.35504 ENSMODP00000024460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]