SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007475363.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007475363.1.35504
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000743
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 55-182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000119
Family Growth factor receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007475363.1.35504
Sequence length 280
Comment PREDICTED: epidermal growth factor-like protein 7 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MWGPGGLLVTWIFILGLGGTESFYRPGRRICSTAATRQTVPVTESYLQRVYQPYITTCEG
HKACSTYRTIYKTAYRYTSQTASPPQYDCCPGWRRSNGIPGCGTAICHSPCQNGGSCARP
GKCKCSAGWQGDTCQIDVDECNKPGHGCPQNCINIPGSYHCQCQQGYELSSDGTLCQPQR
VSPGVTSTLSPTGQPQPEASDEMKEEIQKLRSRVDMLEEKLQLMLAPFHSVAPQVSEDGP
SDHMSLLAHSFQQLDRIDSLSEQILFLEERLETCSCKNKQ
Download sequence
Identical sequences F7AHX7
ENSMODP00000021950 ENSMODP00000021950 XP_007475362.1.35504 XP_007475363.1.35504 XP_007475364.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]