SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007479878.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007479878.1.35504
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily RING/U-box 0.0000489
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  XP_007479878.1.35504
Domain Number - Region: 87-140
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007479878.1.35504
Sequence length 301
Comment PREDICTED: RING finger protein 212B isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MDWFHCNQCFRKDGTHFFVTSCGHIFCKKCVTKEKCAVCGATCKHLALSDNLKPQEKMFF
KSPVETALKYFSHISQVWSFQKKQTDLLITFYKHRLSKSEAAMQEAQRTVASQDKELVIL
RKENGELKKFLAILKESPSRCQGSRSTTPRPVGITSPSQSVTPRPTSQNSNQVVSQPSSL
ESIPYRVSGFGSFGQQGNRGLQGRNTSRESYTDTPSPASTNSLSYGALSASSGPGIFSVS
PYLGGVGGTTGLIPSRSSQSDSRSAPETPVALQLPVLQLQVTPQTPQLHQTRLSNNRGRC
D
Download sequence
Identical sequences F6R5C5
ENSMODP00000005618 XP_007479878.1.35504 ENSMODP00000005618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]