SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007482312.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007482312.1.35504
Domain Number 1 Region: 334-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.12e-21
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 101-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  XP_007482312.1.35504
Domain Number - Region: 160-248
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 216-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0162
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007482312.1.35504
Sequence length 491
Comment PREDICTED: keratin, type I cytoskeletal 10-like isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSQRYGSSRHYSSSRSGGGAGGGSSIRISSTRGSGYGAGSIGGGFSSAGGFGSRSVGGFV
GGFSSSSYGGGSFGGSYGGVSCGGGSFGGLFDGSDGGLLSGNEKVTMQNLNDRLASYLDK
VKALEDSNSQLEQKIKEWYEKYGNSRQREPRDYSHYYDVIKDLKDQILTLTTDNANVLLQ
IDNARLAADDFRLKYENEVALHQSVEADINGLRRVLDDLTLAKTDLEVQLESLNEELAFL
KKNHEEEMKDLQNVSTGDVNVEMNAAPGVDLTENLNLLRSQYEQLAEQNRREAEAWFNEK
SKELTTEINSNVEQVSSQKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCSQ
LSEIQAQITALEEQLQQVRAETEYQNSEYQLLLDIKIRLENEIQTYRSLLEEGGSANSAA
IGHGGSSGGTYRGISGGVQGASSSSGAYGGSSAGSGGVTSSGSRRGSSVVQGGSSGSGGE
STSKSSSGTRF
Download sequence
Identical sequences F7CLT7
ENSMODP00000016949 ENSMODP00000016949 XP_007482312.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]