SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007484913.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007484913.1.35504
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Translational machinery components 1.72e-19
Family Ribosomal protein L18 and S11 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007484913.1.35504
Sequence length 170
Comment PREDICTED: 39S ribosomal protein L18, mitochondrial isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MVLRARGRDLLALCRNPGFRLAPLTTSPNPAPAPEVDPKENEKIAPEFTNRNPRNLERLA
LARKERGWATVWPSRAYWHRLRVNRTQHHIEAFVEHSSGDVVVSASTREWAIKKHLYRTR
NVNACENIGRVLAQRCLEAGINFMAFYPTPWEESSESACSALRYSDYKMP
Download sequence
Identical sequences F7EDX2
ENSMODP00000009217 ENSMODP00000009217 XP_007484913.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]