SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007487124.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007487124.1.35504
Domain Number 1 Region: 31-315
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.19e-43
Family Class I glutamine amidotransferases (GAT) 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007487124.1.35504
Sequence length 315
Comment PREDICTED: gamma-glutamyl hydrolase [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGSSWQRLCALGTVLLCFVRGDVPREDINERPIIGILAQSHKEDLQGLGKYYIAASYVKY
LESAGARVVPIRTTLSDEEYDNLFNSINGILFPGGGVDLQTSKYSYVARLFYDKAKQAFK
RGDYFAIWGTCLGFEELTVLTSGKQLLTPTNTSGIALPLNFTKAINESRMFQNFPKDLLV
ALATEPITSNFHKWSLSLKTFMENKKLSEFYTVLSTNTYKGIEFISTMEAKEYPIYGVQW
HPEKNAFEWKKLKGLVHSPVGIRMSFYMADFFVNEARKSHHRFASKEEEEKALIYNYEPV
FTGNYSSFQQCYFFD
Download sequence
Identical sequences F7FU03
ENSMODP00000010301 ENSMODP00000010301 XP_007487124.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]