SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007487273.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007487273.1.35504
Domain Number 1 Region: 231-367
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00034
Further Details:      
 
Domain Number 2 Region: 461-586
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 348-464
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.00019
Further Details:      
 
Domain Number 4 Region: 32-155
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 141-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000128
Family Cadherin 0.00057
Further Details:      
 
Domain Number 6 Region: 582-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000785
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007487273.1.35504
Sequence length 849
Comment PREDICTED: desmocollin-2 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MATDGPGQFRLETGCHLFLLTLLVLSFSCEACKRVTLNVPSTLEAETFVGRVNLDECLPS
ANIIRSSDPHFRILEDGSVYTTSTVVLSSEKKVFTILLFNREKKEQKHIVVLLEHHKKAL
KKRHLSEAILRRAKRRWAPIPCSLMENSLGPFPMLLQQVQSDSAQNYTVYYSIRGPGVDQ
EPINLFYIERDTGHLYVTRPVDREQCESYALVAFASTPDGYSVDLPLPLEIKIEDENDNA
PVFTEDPCELEIDENCGVGTTVGQVCATDADEPDTMHTRLRYTIIEQQPATPSLFSIHPS
TGVITTTSSRCDREVMDKYCLTVKVQDMDGQYFGLWTKSTCTITLRDVNDNLPVFQRSSY
ITEVEENKNNVEILRLGVEDKDLINTPNWRANYTILKGNEKGNFRIETDPKTNEGILYVV
EGLNYEEARQVVLQIGVTNQVPFCGPGGSKTPSISTTTVTVNVKNQDEGPECSPRMQVIH
VKENIGLGTQVDGYKAYDPEIRNNNAMRYKALTDLRGLFTIDEESGRIKILRSLDRESNT
FKNKMHNITLRVSDRDGRSCTGTLGIVVDDVNDNGPSIPRNTVIVCKNRMGSAEIVAVDP
DEPTNGPPFEFSLEDRFGRDDTMWRLSRINDTATRLSFRNDPAFGTYEVPIIVRDRLGMS
RSNLLNVNLCDCITPNECTSRTATVRGAKDVSLGKWAILAMILGAALLSCILFTLVCGGA
GSSPEKKTFPDDLAQQNLIVSNTEAPGDDRVYCTNGLTTQNMNTGCLLASGAKNGQECFE
MMKGGHQTLESCRGGGHHTLDSCRGGHHTMDSCRGGQVEMDNCRYSEWQNFTQTHLGEES
IRGHTLIKN
Download sequence
Identical sequences F7DL11
XP_007487273.1.35504 ENSMODP00000013899 ENSMODP00000013899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]