SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007489770.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007489770.1.35504
Domain Number 1 Region: 57-524
Classification Level Classification E-value
Superfamily Cytochrome P450 7.86e-119
Family Cytochrome P450 0.00000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007489770.1.35504
Sequence length 541
Comment PREDICTED: phylloquinone omega-hydroxylase CYP4F11-like [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MVPGSEWLSHQLGLGGLKSGVHSVMILFFLALSTWILAQVLFFLNRYYTNIQQLRCFPQP
LIWNWFSGHLGLMDFTEKSLIRIIDYVSTFREVFLMWMGPFRPVIVLCHSDYIRPLTSAS
AHIAPKDNFIYGFLKPWLGDGLLLSGGDKWSRHRRLLTPAFHFDILKPYVKIFNQCADIM
HEKWKRLCAEESTQLDVFDHVSLMTLDTLQKCIFSHNSNCQEKPSKYISTILELSVLSTK
RSNQFFLYWDSVYYLTSQGRSFTQACHLVHDFTDAVIKARQKVLAEQGVEAFLKDKGKGK
TMDFIDILLLSKDEDGKPLSDKDIRAEADTFMFEGHDTTASGISWVLYNLAQHQEYQDRC
RQEIQELMKGRETEEIEWNDLSQMPFLTMCIKESLRLHPPVPIIFRQCTKDIQLPDSRVI
PKGSVCLISIFGTHHNPTVWPNPEVYDPYRFDTNNPQKMSPLAFMPFSAGPRNCIGQNFA
MSEMKVVLALTLLRFRVFPHGNPPRRKLELVLRTESGLWLKVEPVQHSSSSEADLQEAPQ
N
Download sequence
Identical sequences F7DNQ9
ENSMODP00000018351 ENSMODP00000018351 XP_007489770.1.35504 XP_007489771.1.35504 XP_007489772.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]