SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007489774.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007489774.1.35504
Domain Number 1 Region: 47-524
Classification Level Classification E-value
Superfamily Cytochrome P450 4.06e-121
Family Cytochrome P450 0.00000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007489774.1.35504
Sequence length 541
Comment PREDICTED: phylloquinone omega-hydroxylase CYP4F2-like isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLPGSKWLSHHLCLSSLEAEVSSILILAGLTLSTWILVQGLAWAHRYYINCQRLRCFPGP
PCQNWFLGHLGMVSTSEEGIRFIQDVTRHYSDVSLFWFGPLIPVIRLHHPQVISSLVNSS
AFILPKDDFFYSFLEPWLGNGLLLSKGDKWSQHRRLLTPAFHFGILKSYVKIFSQGADIM
HAKWRRLCAEGNTRLDMFEHVSLMTLDSLQKCIFSYDSNCQEKPSAYISAILELSSLVTK
RFQKPLLFWDALYSLTSEGRCFSRACRLVHHFSEAVIQDRRQILTKQGTESFLREKGKRK
TMDFIDILLLAKDKDGKTLSNKDIQAEADTFMFGGHDTTASGISWALYNLAQHPEHQNRC
RQEIEELLKGRQPEEIEWDDLANMPFLTMCIKESLRIHPPVPMVSRYCTKDIQLPDGRVI
PKGNICLISIFGTHHNPAVWPNPEVYNPYRFDTNNAEKIPPLAFIPFSAGPRNCIGQNFA
LYEMKVVLALTLLRFRVFPDDHPVRRKSELILRADNGLWLKLEPVLGPSGPEKPLSSVSQ
E
Download sequence
Identical sequences F6YMC4
ENSMODP00000018447 XP_007489773.1.35504 XP_007489774.1.35504 ENSMODP00000018447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]