SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007490803.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007490803.1.35504
Domain Number 1 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 649-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 9 Region: 35-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-21
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 10 Region: 706-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007490803.1.35504
Sequence length 757
Comment PREDICTED: zinc finger protein 345-like isoform X3 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSTKLRLFVEGSGPQRYMNEVPHDFILREICDSDIQGSLTFKDVAVDFTQDEWCLLDNSQ
KELYLEVMLENVQNLLSVGLPVPREYLTSCFQQGEAPWLLEQEVPRSSCPEAETNFEVKG
FSTKQQIFVEGSDPKRCMNEGSCDFILREICDSDIKINKNVKSECECDDPSEKFNQYSVL
NQHVTLTSGNVCCQDTQYSKCFPDEVRLFQWNEKPSEKPMYQGNLGGIGFGCTLDFIRYP
KSKWVEIVSVKDEGGKPFSQNSDLAAYQIIHSGEKPYECKQCGKAFTKRNHLSTHQRIHS
GEKPYECKQCGKAFTQKSHLSTHQRIHSGEKPYDCKQCGKAFTRRSHLSTHQRIHSGKKP
YECKQCRKAFTRKGSLAAHQRIHTGEKPYECKQCGKAFKWTASLAAHQRSHSGEKPYECK
QCRKAFTQRGSLAAHQRIHTGEKPYECKQCGKTFKWKVSLAAHQKIHAGDKSYECKQCGK
AFTQRCHLSTHERIHSGKKPYECKQCGKGFTQRGNLATHQSIHTGEKPYKCKHCGKPFKW
RVSLVAHQRIHTGEKPYECKQCGKAFTGSKYLVAHQQIHTGEKPYECKQCGKAFIQRSYL
SRHQRIHSGKQPYECKQCGKAFKWKISLAAHQSIHTGEKPYECKQCGKAFKWKVSFAAHQ
RNHTGEKPSECKQCGKAFTRRSHLSTHQIIHSGKKPYKCKQCGKDFTQRSHLALHQSIHT
GEKPYKCQQCGKPFKWKVSLAAHQRIYTGEKSYKCKQ
Download sequence
Identical sequences F6TQ07
ENSMODP00000029740 XP_007490803.1.35504 XP_007490804.1.35504 ENSMODP00000029740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]