SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007491161.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007491161.1.35504
Domain Number 1 Region: 632-970
Classification Level Classification E-value
Superfamily RNI-like 1.81e-73
Family 28-residue LRR 0.0000419
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-25
Family Pyrin domain, PYD 0.0014
Further Details:      
 
Domain Number 3 Region: 1000-1098
Classification Level Classification E-value
Superfamily RNI-like 1.49e-21
Family 28-residue LRR 0.0031
Further Details:      
 
Domain Number 4 Region: 223-401
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000127
Family Nucleotide and nucleoside kinases 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007491161.1.35504
Sequence length 1125
Comment PREDICTED: NACHT, LRR and PYD domains-containing protein 3 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTESVRCILVRYLEELTFEELKKFKLFLEDSPPKEKFLRIPRSQMKKADNTDMAELMVHH
YGEGEAWDVALMIWEKMGLRELWEQAKREAPQMEKLRWNSRFLKGKDKKSERRKLGFWKH
VDKLMKKWSGQDHMDQWNEGCQTTYRNRIMEKFRVMRDRNSCPGEYENLHHRFTRLLLLQ
EYRHREQKEHELLAIGWEHAEIMENQGQLIEVASLFDPDKKREAHPQVVVLQGAAGIGKT
TLARKVILDWAEGNLYQDKFDYVFYLHCREMNHLREKKIRFADLIANDWPFLEASMKRIL
SHPEKLLFVIDGLDELKFSCDEHSYDLCKDWNLQQPVPILLSSLLRKTMLLESSLLITTR
LTALEKCDFLFENPRHVEILGFSEEDRWKYFCKFFGDEDQAQQAFSLIVNNETLFTMCFV
PLMCWIICTCMKQQMRRKKDLKQASKTTTTLYMCYLSSLATPGARSCSVQHHRSLCRMAA
EGIWEGKILFDGDDLRRHGLEASDVSAFLDMHIFQKDSDSENCYSFIHLSFQEFFAAMFY
ALGEEKETGGRAVPPIPGVKDLLAKCRDSATSFVALTVHFLFGFLNADNRKRLEEIYDCK
ISQEIKLELLQWIQAVTEQQHKDPSLRNDLLEMFSHLYETQDEEFVTTAMAHFQEISLNI
YSKLHFLISVFCIKFCHNLGKIRLNIARFQMKSLQFKVFQLAVVDWQHLFSVLSKNQNLR
TLDLSGTELANSAVNALCSELSQSSCKLQKLSLSKCQLTASCCQHLSSLLKNNKNLTYLD
LSMNFLGDEGIKALCEVLRNQNCNIQELNLSRCRFSDACCKNLSSALMAHGNINILDLSE
NTLADVGMNLLCEALGSSDCNLQELKLSQCHFTDACCQDLSTCIKNQSLIHLDVSGNFLQ
DSGIRLLCEALRHPTCNLQKLLLSLCHITDSSCQDVSFALKNNRSLIHLDLGCNNLYNHG
VKLLCEALENQNCNLQTLELWNCQLSAACCHEFSSVLKKNQSLTHLNLGANPLRNNGVKV
LCEALGNQNCKLQKLKLCKCLLSAVGCRYLSTALKSNQNLTHLKLTGNGLGDDGVKLLFE
ALKNSDCKLQKLTLDKWKLSADTQRIQDELRQRKPHLIIENSSLC
Download sequence
Identical sequences F7GHL5
XP_007491160.1.35504 XP_007491161.1.35504 ENSMODP00000025242 ENSMODP00000025242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]