SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007493105.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007493105.1.35504
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.75e-46
Family DJ-1/PfpI 0.0000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007493105.1.35504
Sequence length 189
Comment PREDICTED: protein deglycase DJ-1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MASKKALVILAKGAEEMETVIPVDLMRRAGIKVVLAGLSGKDPVQCSRDVFICPDESLED
AKKQGPYDVIVLPGGNLGAQNLCESPVVKTLLKEQEKNKGLIAAVCAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYTYTESRVEKDGNILTSRGPGTSFEFGLAIIAELMGKSVVDQ
VKGPLVLKD
Download sequence
Identical sequences F7A9B9
ENSMODP00000011989 ENSMODP00000011989 XP_007493105.1.35504 XP_007493106.1.35504 XP_007493107.1.35504 13616.ENSMODP00000011989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]