SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007497872.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_007497872.1.35504
Domain Number - Region: 242-276
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007497872.1.35504
Sequence length 308
Comment PREDICTED: uncharacterized protein LOC103101030 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGLCHSRKSGSVTPQSDKVMSDTTDKRSIMSNNEGSVMDMPQRSRMTTEALESGEEAPTW
TCLQDLKMCLQEAEDKVKTLSEQLAVSEGTKTKLLEQVSWLEEQLETADIKEVRGEPYEE
IMHAKNQRIEKLQAEVKASQEQLAAHKLKHKRKMKKLQTDLATAKQEAAITVLELNEKIK
TLYEGKPSPRGCLRISFRLLKCKISTIRTCILATRIPEENSLEESCGGLPPVEEGDRRMS
LIMELSTQVSLQTEKINQLEEVLEEKERKIQQLEAERETPMFQMGSPPECLPEAPSASND
RTSAVDID
Download sequence
Identical sequences K7E384
XP_007497872.1.35504 ENSMODP00000040235 ENSMODP00000040235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]