SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007498679.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007498679.1.35504
Domain Number 1 Region: 7-43
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000718
Family BAFF receptor-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007498679.1.35504
Sequence length 184
Comment PREDICTED: tumor necrosis factor receptor superfamily member 17 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MQTTQRCFQNEYLDNLLHACKPCHLRCSNTPPLVCQSYCNASTTSSLKIIDVNLWIYLSV
GIISSLTVFLLILMLKKRSPERSKEELKNTETKAELKEIIKVDLDRNENDEAGIFPRNST
TMTYMVEECKYKDCGEGDDISFPFPTMEEGATVFVDTKTNDFCKSSPSSMNDTFMGLWKS
VFTT
Download sequence
Identical sequences F6Y173
ENSMODP00000005835 XP_007498679.1.35504 ENSMODP00000005835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]