SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499276.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499276.1.35504
Domain Number 1 Region: 14-40,69-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-42
Family G proteins 0.0000354
Further Details:      
 
Domain Number 2 Region: 222-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000942
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007499276.1.35504
Sequence length 314
Comment PREDICTED: ras-related protein Rab-40C isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRGRMGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNDSPLDKVEC
LRTDSNFTSIVLIRCLILTSGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGA
QGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARSYAEK
NCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVH
LIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASSGGGSSSKGNSLKRSKSIRPPQ
SPPQNCSRSNCKIS
Download sequence
Identical sequences XP_007499275.1.35504 XP_007499276.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]