SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007500851.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007500851.1.35504
Domain Number 1 Region: 269-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-36
Family Laminin G-like module 0.00000506
Further Details:      
 
Domain Number 2 Region: 473-673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-26
Family Laminin G-like module 0.0000537
Further Details:      
 
Domain Number 3 Region: 44-94
Classification Level Classification E-value
Superfamily GLA-domain 9.92e-20
Family GLA-domain 0.00054
Further Details:      
 
Domain Number 4 Region: 122-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.0092
Further Details:      
 
Weak hits

Sequence:  XP_007500851.1.35504
Domain Number - Region: 244-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007500851.1.35504
Sequence length 680
Comment PREDICTED: vitamin K-dependent protein S [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLGLLTMRVLGGLLISLFFMIQISEAENFLSKQHASQILVRKRRANTFMEETKKGNLERE
CIEELCNKEEAREVFENDPETNYFYPLYLACLGSFRVGSFVAARQSTNAYTDLRSCVNAI
PNQCNPLPCNEVGYERCIDGQAEFICVCKPGWYGTMCEEDINECEDPSYKKGGCSQICTN
LPGTYRCSCESGFYLLPDKKECRDINECAFSSKVCGNALCKNTPGDFECECPKGYIYNPI
SMECEDVDECAENTCAQLCVNHPGGYTCYCDGKKGFRLVQDQKNCEAVPLCLPLNLEKNY
ELLYLAEQFVGIPVLYLRFRLPEATRFSAEFDFRTYDPEGIILYAESIDHSAWFLVALRD
GKIEIQFKNEHGTKVTSGGKIINNGLWNIVSVEELENSISVKIAKEAVMNINSPGRLFRP
FKNGFLEIKVFFAGLPRMAENNLLKSINPRLDGCIRGWNLMNQGASGVKEIIQEKQNKHC
LVTVEKGSYYPGSGVAQFDIDYRNVLNPEEWQINVTLSVRPSAGTGVLLALVSGDAVPLA
LSLVDSSTSDLQDILVTIENTTVSRMEAKKLCTHEYSKVELRVSRGLLELTNGLDGETIY
HEDLKAKLAILDRAMTGRITTYLGGIPDVPINASLVNVFYNGCMDVKINGRELDLDEAIF
KQNDIRSHSCPTVSKNPNTF
Download sequence
Identical sequences F6UL60
XP_007500851.1.35504 ENSMODP00000021186 ENSMODP00000021186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]