SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007503011.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007503011.1.35504
Domain Number 1 Region: 25-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-37
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007503011.1.35504
Sequence length 204
Comment PREDICTED: SPRY domain-containing protein 4 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MALPLTRVLRREAVWLGAAGTATRRAISFKLEEKTAHSSLALFKEETGVKYGLVGLEPTK
VALNVERFRDWAVVLGDTRVTTGQHYWEVTVKKSKHFRIGVADVDIPRDGCIGVDSHSWV
FAYAHQKWHAMLAKESFPITGIGHPEKVGLLLNYEAQRLSLVDISRTAVVYTLRTEFHGP
VVPAFALWDGQLLTHSGLDVPEGM
Download sequence
Identical sequences F6QBR8
XP_007503011.1.35504 ENSMODP00000026444 ENSMODP00000026444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]