SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007506375.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007506375.1.35504
Domain Number 1 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 9-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 150-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000804
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007506375.1.35504
Sequence length 512
Comment PREDICTED: zinc finger protein 501-like isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAPGSPGLQAQEAVTFRDVAVDFSQEEWRLLAPPQKELYKEVMLENAQNLLSLGFLQFSH
SQCPGLPVPREDLISYLEQREAPWIREQEGRRSCCPEGEIRPKWKEPPTEPVFSLEGTHK
QRFMNDGPWYVTWREFWAEYQRILNKEKAHKAFGQQSSCIYHQKTDTEKKLHKCHACPET
FNKQSSLIRHQRIHTEEKPYECHQCGKAFGQRVSLAQHQRIHTGEKIFKCHHCGKAFGQQ
SSLIYHQKTHIGKKTHECHECSKAFSEHSSLIRHQRIHSGEKPHECRQCGKAFIQRASLV
QHQRIHSGEKPYKCTQCGKTFTVSSSLALHQRIHTGEKPYECNQCRKTFTNCSNLVLHQR
IHTGEKPYECSQCGKTFTTSSHLARHQRIHTGEKPYECNQCGKTFAQSSNLAGHQRIHSG
EKPYECKQCGRTFTLSSHLARHQRIHSGEKPYTCNQCRKTFTLSSSLAQHQRIHIGEKPY
EYSQCRKTFTLSFHFVPHQKIHTGVNLKNNSQ
Download sequence
Identical sequences H9H758
ENSMODP00000023240 XP_007506375.1.35504 ENSMODP00000023240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]